PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G14350.1
Common NameAtMYB124, FLP, MYB124
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 436aa    MW: 49599.6 Da    PI: 6.8758
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G14350.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.3e-142771348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      W++eEd +l + ++++G+++W+ Ia+++   ++  qc+ rw++yl
      AT1G14350.1 27 TWSQEEDVILREQITLHGTENWAIIASKFK-DKSTRQCRRRWYTYL 71
                     6****************************9.*************97 PP

2Myb_DNA-binding42.81.2e-1377120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg W++eEd ll +a + +G++ W+ Ia+ +  gRt++ +k+r+ +
      AT1G14350.1  77 RGGWSPEEDMLLCEAQRVFGNR-WTEIAKVVS-GRTDNAVKNRFTT 120
                      789*******************.*********.**********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.79E-101468IPR009057Homeodomain-like
PROSITE profilePS5129415.2532071IPR017930Myb domain
SMARTSM007173.1E-122473IPR001005SANT/Myb domain
CDDcd001671.41E-112771No hitNo description
Gene3DG3DSA:1.10.10.603.0E-192878IPR009057Homeodomain-like
PfamPF139211.3E-142888No hitNo description
SuperFamilySSF466891.2E-2450132IPR009057Homeodomain-like
PROSITE profilePS5129419.92372126IPR017930Myb domain
SMARTSM007172.0E-1476124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-1979125IPR009057Homeodomain-like
CDDcd001672.78E-1080121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009553Biological Processembryo sac development
GO:0010052Biological Processguard cell differentiation
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0000351anatomyguard mother cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MEDTKKKKKK NINNNQDSKK KERHIVTWSQ EEDVILREQI TLHGTENWAI IASKFKDKST  60
RQCRRRWYTY LNSDFKRGGW SPEEDMLLCE AQRVFGNRWT EIAKVVSGRT DNAVKNRFTT  120
LCKKRAKHEA MTKDSNSNTK RMLFLDGIST PRKSENETPI AKKLKRSHIL DLTEISNYGR  180
AEACVNQQIR SPFSVLARNA TGIDSLEEQN QTSNVNESDG EGMFLKKDDP KVTALMQQAE  240
LLSSLAQKVN ADNTEQSMEN AWKVLQDFLN KGKENDLFRY GIPDIDFKIE EFKDLIEDLR  300
SGYEDNQLSW RQPDLHDSPA SSEYSSGSTI MVDQSGDKTQ PFSADTQTEH KQVGEELLVP  360
KNPDENMPIS GEEKFSSPIQ VTPLFRSLAD GIPSPQFSES ERSFLLKTLG IESSSPCPSA  420
NPSKPPPCKR VLLHSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-262812610108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.120410.0bud| flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261491_at0.0
Expression AtlasAT1G14350-
AtGenExpressAT1G14350-
ATTED-IIAT1G14350-
Functional Description ? help Back to Top
Source Description
TAIREncodes a putative MYB transcription factor involved in stomata development, loss of FLP activity results in a failure of guard mother cells (GMCs) to adopt the guard cell fate, thus they continue to divide resulting in abnormal stomata consisting of clusters of numerous guard cell-like cells. This phenotype is enhanced in double mutants with MYB88.
Function -- GeneRIF ? help Back to Top
  1. targets. FLP recognizes a distinct cis-regulatory element that overlaps with that of the cell cycle activator E2F-DP in the CDKB1;1 promoter, suggesting that these MYBs may also modulate E2F-DP pathways
    [PMID: 20675570]
  2. flp-1 myb88 double mutant plants show enhanced sensitivity to drought and salt stress.
    [PMID: 21105921]
  3. FLP and MYB88 are important regulators of entry into megasporogenesis, and probably act via the regulation of cell cycle genes.
    [PMID: 22915737]
  4. FLP and MYB88 restrict the G1/S transition during stomatal formation.
    [PMID: 24123248]
  5. Data indicate that MYB transcription factor FOUR LIPS (FLP) and bHLH transcription factor FAMA complement respective mutant phenotypes.
    [PMID: 24571519]
  6. Data indicate that bHLH transcription factor FAMA and MYB transcription factor FOUR LIPS (FLP) genes stabilize guard cell fate.
    [PMID: 24654956]
  7. Both flp and myb88 genes were expressed in many, previously unreported locations, consistent with the possibility of additional functions for FLP and MYB88. Moreover, expression domains especially of FLP display sharp cutoffs or boundaries.
    [PMID: 26391711]
  8. ARF7 and FLP transcription factors jointly form a coherent feed-forward motif that mediates the auxin-responsive PIN3 transcription in planta to steer the early steps of lateral root formation.
    [PMID: 26578065]
  9. FLP and MYB88 expression specifically determines the temporal-spatial patterns of PIN3 and PIN7 transcription that are closely associated with their preferential functions during root responses to gravity.
    [PMID: 26578169]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G14350.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G54180(R), AT4G34160(A)
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G14350
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719820.0AF371982.2 Arabidopsis thaliana putative transcription factor MYB124 (MYB124) mRNA, complete cds.
GenBankBT0261260.0BT026126.1 Arabidopsis thaliana.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077534.10.0MYB transcription factor FLP
RefseqNP_563948.10.0MYB transcription factor FLP
TrEMBLQ94FL60.0Q94FL6_ARATH; At1g14350
STRINGAT1G14350.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33742863
Representative plantOGRP54161421
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. von Groll U,Altmann T
    Stomatal cell biology.
    Curr. Opin. Plant Biol., 2001. 4(6): p. 555-60
    [PMID:11641073]
  4. Von Groll U,Berger D,Altmann T
    The subtilisin-like serine protease SDD1 mediates cell-to-cell signaling during Arabidopsis stomatal development.
    Plant Cell, 2002. 14(7): p. 1527-39
    [PMID:12119372]
  5. Dewitte W, et al.
    Altered cell cycle distribution, hyperplasia, and inhibited differentiation in Arabidopsis caused by the D-type cyclin CYCD3.
    Plant Cell, 2003. 15(1): p. 79-92
    [PMID:12509523]
  6. Lai LB, et al.
    The Arabidopsis R2R3 MYB proteins FOUR LIPS and MYB88 restrict divisions late in the stomatal cell lineage.
    Plant Cell, 2005. 17(10): p. 2754-67
    [PMID:16155180]
  7. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  8. Xie Z, et al.
    Regulation of cell proliferation in the stomatal lineage by the Arabidopsis MYB FOUR LIPS via direct targeting of core cell cycle genes.
    Plant Cell, 2010. 22(7): p. 2306-21
    [PMID:20675570]
  9. Xie Z,Li D,Wang L,Sack FD,Grotewold E
    Role of the stomatal development regulators FLP/MYB88 in abiotic stress responses.
    Plant J., 2010. 64(5): p. 731-9
    [PMID:21105921]
  10. Vanneste S, et al.
    Developmental regulation of CYCA2s contributes to tissue-specific proliferation in Arabidopsis.
    EMBO J., 2011. 30(16): p. 3430-41
    [PMID:21772250]
  11. Nadeau JA,Sack FD
    Stomatal development in Arabidopsis.
    Arabidopsis Book, 2002. 1: p. e0066
    [PMID:22303215]
  12. Makkena S,Lee E,Sack FD,Lamb RS
    The R2R3 MYB transcription factors FOUR LIPS and MYB88 regulate female reproductive development.
    J. Exp. Bot., 2012. 63(15): p. 5545-58
    [PMID:22915737]
  13. Lee E,Liu X,Eglit Y,Sack F
    FOUR LIPS and MYB88 conditionally restrict the G1/S transition during stomatal formation.
    J. Exp. Bot., 2013. 64(16): p. 5207-19
    [PMID:24123248]
  14. Lee E,Lucas JR,Sack FD
    Deep functional redundancy between FAMA and FOUR LIPS in stomatal development.
    Plant J., 2014. 78(4): p. 555-65
    [PMID:24571519]
  15. Lee E,Lucas JR,Goodrich J,Sack FD
    Arabidopsis guard cell integrity involves the epigenetic stabilization of the FLP and FAMA transcription factor genes.
    Plant J., 2014. 78(4): p. 566-77
    [PMID:24654956]
  16. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  17. Lei Q, et al.
    The FOUR LIPS and MYB88 transcription factor genes are widely expressed in Arabidopsis thaliana during development.
    Am. J. Bot., 2015. 102(9): p. 1521-8
    [PMID:26391711]
  18. Chen Q, et al.
    A coherent transcriptional feed-forward motif model for mediating auxin-sensitive PIN3 expression during lateral root development.
    Nat Commun, 2015. 6: p. 8821
    [PMID:26578065]
  19. Wang HZ, et al.
    Transcriptional regulation of PIN genes by FOUR LIPS and MYB88 during Arabidopsis root gravitropism.
    Nat Commun, 2015. 6: p. 8822
    [PMID:26578169]
  20. Serna L,Fenoll C
    Tracing the ontogeny of stomatal clusters in Arabidopsis with molecular markers.
    Plant J., 1997. 12(4): p. 747-55
    [PMID:9375390]
  21. Geisler M,Yang M,Sack FD
    Divergent regulation of stomatal initiation and patterning in organ and suborgan regions of the Arabidopsis mutants too many mouths and four lips.
    Planta, 1998. 205(4): p. 522-30
    [PMID:9684356]